PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 438aa    MW: 48384.7 Da    PI: 7.4559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13094.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.24e-183882146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W++eEd ll ++v+q+G ++W+ Iar ++ gR++k+c++rw +
       KHN13094.1 38 KGPWSPEEDALLSRLVAQFGARNWSMIARGVP-GRSGKSCRLRWCN 82
                     79******************************.***********87 PP

2Myb_DNA-binding52.51.1e-1684128247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+W++eEd ll ++v+q+G ++W  Iar ++ gR+ k+c++rw + 
       KHN13094.1  84 GPWSPEEDALLSRLVAQFGARNWGMIARGVP-GRSSKSCRLRWCNQ 128
                      89*****************************.***********985 PP

3Myb_DNA-binding56.18.5e-18135179147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
       KHN13094.1 135 RKPFTEEEDNIIVSAHAIHGNK-WAIIAKLLP-GRTDNAIKNHWNST 179
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0723388IPR017930Myb domain
SuperFamilySSF466898.61E-153582IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-193782IPR009057Homeodomain-like
SMARTSM007174.7E-93781IPR001005SANT/Myb domain
PfamPF002491.5E-163882IPR001005SANT/Myb domain
CDDcd001674.71E-154082No hitNo description
SMARTSM007173.5E-1582131IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-3083176IPR009057Homeodomain-like
PfamPF002492.8E-1584128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2584136IPR009057Homeodomain-like
CDDcd001671.71E-1485127No hitNo description
PROSITE profilePS5129425.783130184IPR017930Myb domain
SMARTSM007171.3E-16134182IPR001005SANT/Myb domain
PfamPF002491.0E-15135179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-23137183IPR009057Homeodomain-like
CDDcd001677.09E-13137180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MTEEDRSAQE TVHNGVASTE LGGEEMDIAE VTAAGRVKGP WSPEEDALLS RLVAQFGARN  60
WSMIARGVPG RSGKSCRLRW CNQGPWSPEE DALLSRLVAQ FGARNWGMIA RGVPGRSSKS  120
CRLRWCNQLD PCLKRKPFTE EEDNIIVSAH AIHGNKWAII AKLLPGRTDN AIKNHWNSTL  180
TRKRMEMGRY VPAHADVIED GTGNFEKTKA SSEETMSIGD INSLNPAEVR NVMMNDETKP  240
PTKDDAKVEE HATLHRPVAR VSAFSFYNSP GRPTMGSCSK MFPRQSPLIQ SPKPDVGPCK  300
LFDNIDCEPM VSSKDDAKVE EHATLHRPVA RVSAFSFYNS PGRPTMGSCS KMFPRQSPLI  360
QSPKPDVGSC KLFDNIDCEP MVPSQCGHGC CSGDSRESHL HGSLLGPEFV DYLESPFSSH  420
AFLSIATDLN CCPKYHRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-45371836158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-45371836158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006575526.10.0PREDICTED: transcription factor MYB104
TrEMBLA0A0B2PZI70.0A0A0B2PZI7_GLYSO; Myb-related protein B
STRINGGLYMA02G42030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3512322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-80myb domain protein 109
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]